Crystal structure of a c-terminal coiled coil domain of transient receptor potential (trp) channel subfamily p member 2 (trpp2, polycystic kidney disease 2)
PDB DOI: 10.2210/pdb3hrn/pdb
Classification: TRANSPORT PROTEIN Organism(s): Salmonella Enterica
Deposited: 2009-06-09 Deposition Author(s): Buraei, Z. , Chen, X.-Z. , Isacoff, E.Y. , Li, M.-H. , Ong, A.C.M. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of a c-terminal coiled coil domain of transient receptor potential (trp) channel subfamily p member 2 (trpp2, polycystic kidney disease 2)
Buraei, Z. , Chen, X.-Z. , Isacoff, E.Y. , Li, M.-H. , Ong, A.C.M. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y.
Primary Citation of Related Structures: 3HRN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2) | A | 64 | Salmonella Enterica | MGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-06-09 Deposition Author(s): Buraei, Z. , Chen, X.-Z. , Isacoff, E.Y. , Li, M.-H. , Ong, A.C.M. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y.