Crystal structure of human bromodomain containing 9 isoform 1 (brd9)
PDB DOI: 10.2210/pdb3hme/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2009-05-29 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A. , Eswaran, J. , Filippakopoulos, P. , Keates, T. , Knapp, S. , Picaud, S. , Roos, A. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J.
Crystal structure of human bromodomain containing 9 isoform 1 (brd9)
Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A. , Eswaran, J. , Filippakopoulos, P. , Keates, T. , Knapp, S. , Picaud, S. , Roos, A. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 3HME
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 9 | A | 123 | Homo Sapiens | SMLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS |
| Bromodomain-containing protein 9 | B | 123 | Homo Sapiens | SMLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-29 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A. , Eswaran, J. , Filippakopoulos, P. , Keates, T. , Knapp, S. , Picaud, S. , Roos, A. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J.