Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
PDB DOI: 10.2210/pdb3hi2/pdb
Classification: DNA BINDING PROTEIN/TOXIN Organism(s): Escherichia Coli K-12
Deposited: 2009-05-18 Deposition Author(s): Arruda, J.M. , Brown, B.L. , Grigoriu, S. , Page, R. , Peti, W.
Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
Arruda, J.M. , Brown, B.L. , Grigoriu, S. , Page, R. , Peti, W.
Primary Citation of Related Structures: 3HI2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional regulator mqsA(ygiT) | A | 76 | Escherichia Coli K-12 | MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVK |
| HTH-type transcriptional regulator mqsA(ygiT) | C | 76 | Escherichia Coli K-12 | MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVK |
| Motility quorum-sensing regulator mqsR | B | 101 | Escherichia Coli K-12 | GSHMEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKEK |
| Motility quorum-sensing regulator mqsR | D | 101 | Escherichia Coli K-12 | GSHMEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKEK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-18 Deposition Author(s): Arruda, J.M. , Brown, B.L. , Grigoriu, S. , Page, R. , Peti, W.