Structural and functional characterization of a novel homodimeric three-finger neurotoxin from the venom of ophiophagus hannah (king cobra)
PDB DOI: 10.2210/pdb3hh7/pdb
Classification: TOXIN Organism(s): Ophiophagus Hannah
Deposited: 2009-05-15 Deposition Author(s): Bertrand, D. , Chong, M.Z. , D'Hoedt, D. , Foo, C.S. , Kini, R.M. , Nirthanan, S. , Rajagopalan, N. , Roy, A. , Sivaraman, J. , Zhou, X.
Structural and functional characterization of a novel homodimeric three-finger neurotoxin from the venom of ophiophagus hannah (king cobra)
Bertrand, D. , Chong, M.Z. , D'Hoedt, D. , Foo, C.S. , Kini, R.M. , Nirthanan, S. , Rajagopalan, N. , Roy, A. , Sivaraman, J. , Zhou, X.
Primary Citation of Related Structures: 3HH7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Muscarinic toxin-like protein 3 homolog | A | 65 | Ophiophagus Hannah | TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ |
| Muscarinic toxin-like protein 3 homolog | B | 65 | Ophiophagus Hannah | TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-15 Deposition Author(s): Bertrand, D. , Chong, M.Z. , D'Hoedt, D. , Foo, C.S. , Kini, R.M. , Nirthanan, S. , Rajagopalan, N. , Roy, A. , Sivaraman, J. , Zhou, X.