Crystal structure of chemically synthesized hiv-1 protease with reduced isostere mvt-101 inhibitor
PDB DOI: 10.2210/pdb3hau/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): N.A.
Deposited: 2009-05-02 Deposition Author(s): Kent, S.B.H. , Torbeev, V.Y.
Crystal structure of chemically synthesized hiv-1 protease with reduced isostere mvt-101 inhibitor
Primary Citation of Related Structures: 3HAU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 protease | A | 99 | N.A. | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEELNLPGCWKPKLIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| HIV-1 protease | B | 99 | N.A. | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEELNLPGCWKPKLIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-02 Deposition Author(s): Kent, S.B.H. , Torbeev, V.Y.