Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.1 angstroms
PDB DOI: 10.2210/pdb3h9v/pdb
Classification: TRANSPORT PROTEIN Organism(s): Danio Rerio
Deposited: 2009-04-30 Deposition Author(s): Gouaux, E. , Kawate, T. , Michel, J.C.
Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.1 angstroms
Gouaux, E. , Kawate, T. , Michel, J.C.
Primary Citation of Related Structures: 3H9V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| P2X purinoceptor | A | 356 | Danio Rerio | GSSKKVGTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDF |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-04-30 Deposition Author(s): Gouaux, E. , Kawate, T. , Michel, J.C.