3H91
Crystal structure of the complex of human chromobox homolog 2 (cbx2) and h3k27 peptide
PDB DOI: 10.2210/pdb3h91/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-04-29 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Crystal structure of the complex of human chromobox homolog 2 (cbx2) and h3k27 peptide
Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Primary Citation of Related Structures: 3H91
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 2 | A | 54 | Homo Sapiens , Synthetic Construct | EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKE |
| Chromobox protein homolog 2 | B | 54 | Homo Sapiens , Synthetic Construct | EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKE |
| H3K27 peptide | C | 15 | Homo Sapiens , Synthetic Construct | QLATKAARKSAPATG |
| H3K27 peptide | D | 15 | Homo Sapiens , Synthetic Construct | QLATKAARKSAPATG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-04-29 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.