Crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution
PDB DOI: 10.2210/pdb3h8u/pdb
Classification: structural genomics, unknown function Organism(s): Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578
Deposited: 2009-04-29 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 3H8U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| uncharacterized conserved protein with double-stranded beta-helix domain | A | 125 | Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 | GMGVNMRAETESRIFSVDEYVRPSNGEPIRSVVLETNDSVVVVWHAHPGQEIASHVHPHGQDTWTVISGEAEYHQGNGIVTHLKAGDIAIAKPGQVHGAMNSGPEPFIFVSVVAPGNAGFALAEK |
| uncharacterized conserved protein with double-stranded beta-helix domain | B | 125 | Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 | GMGVNMRAETESRIFSVDEYVRPSNGEPIRSVVLETNDSVVVVWHAHPGQEIASHVHPHGQDTWTVISGEAEYHQGNGIVTHLKAGDIAIAKPGQVHGAMNSGPEPFIFVSVVAPGNAGFALAEK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-04-29 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)