Crystal structure of the human transcription elongation factor dsif, hspt4/hspt5 (176-273)
PDB DOI: 10.2210/pdb3h7h/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2009-04-27 Deposition Author(s): Martins, B.M. , Rosch, P. , Wenzel, S. , Wohrl, B.M.
Crystal structure of the human transcription elongation factor dsif, hspt4/hspt5 (176-273)
Martins, B.M. , Rosch, P. , Wenzel, S. , Wohrl, B.M.
Primary Citation of Related Structures: 3H7H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription elongation factor SPT4 | A | 120 | Homo Sapiens | GAMGALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
| Transcription elongation factor SPT5 | B | 106 | Homo Sapiens | GSHMDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLGSGC |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-04-27 Deposition Author(s): Martins, B.M. , Rosch, P. , Wenzel, S. , Wohrl, B.M.