Crystal structure of trypanosoma cruzi thioredoxin-like hypothetical protein q4dv70
PDB DOI: 10.2210/pdb3h79/pdb
Classification: UNKNOWN FUNCTION Organism(s): Trypanosoma Cruzi
Deposited: 2009-04-24 Deposition Author(s): Barbosa, J.A.R.G. , Fessel, M.R. , Goldenberg, S. , Guimaraes, B.G. , Krieger, M.A. , Santos, C.R. , Vieira, L.C. , Zanchin, N.I.T.
Crystal structure of trypanosoma cruzi thioredoxin-like hypothetical protein q4dv70
Barbosa, J.A.R.G. , Fessel, M.R. , Goldenberg, S. , Guimaraes, B.G. , Krieger, M.A. , Santos, C.R. , Vieira, L.C. , Zanchin, N.I.T.
Primary Citation of Related Structures: 3H79
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin-like protein | A | 127 | Trypanosoma Cruzi | GHMASNVANDGERPSRVVELTDETFDSIVMDPEKDVFVLYYVPWSRHSVAAMRLWDDLSMSQSQKRNHLTFVAARIDGEKYPDVIERMRVSGFPTMRYYTRIDKQEPFEYSGQRYLSLVDSFVFQNT |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-04-24 Deposition Author(s): Barbosa, J.A.R.G. , Fessel, M.R. , Goldenberg, S. , Guimaraes, B.G. , Krieger, M.A. , Santos, C.R. , Vieira, L.C. , Zanchin, N.I.T.