Crystal structure of staphylococcal nuclease variant delta+phs v104e at cryogenic temperature
PDB DOI: 10.2210/pdb3h6m/pdb
Classification: HYDROLASE Organism(s): Staphylococcus Aureus
Deposited: 2009-04-23 Deposition Author(s): Garcia-Moreno, E.B. , Heroux, A. , Khangulov, V.S. , Schlessman, J.L.
Crystal structure of staphylococcal nuclease variant delta+phs v104e at cryogenic temperature
Garcia-Moreno, E.B. , Heroux, A. , Khangulov, V.S. , Schlessman, J.L.
Primary Citation of Related Structures: 3H6M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thermonuclease | A | 143 | Staphylococcus Aureus | ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-04-23 Deposition Author(s): Garcia-Moreno, E.B. , Heroux, A. , Khangulov, V.S. , Schlessman, J.L.