Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
PDB DOI: 10.2210/pdb3h00/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus Type 1 Lw12.3 Isolate
Deposited: 2009-04-08 Deposition Author(s): Liu, J.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Envelope glycoprotein gp160 | A | 39 | Human Immunodeficiency Virus Type 1 Lw12.3 Isolate | NNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFN |
Envelope glycoprotein gp160 | B | 39 | Human Immunodeficiency Virus Type 1 Lw12.3 Isolate | NNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFN |
Envelope glycoprotein gp160 | C | 39 | Human Immunodeficiency Virus Type 1 Lw12.3 Isolate | NNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFN |
Envelope glycoprotein gp160 | D | 39 | Human Immunodeficiency Virus Type 1 Lw12.3 Isolate | NNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFN |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-04-08 Deposition Author(s): Liu, J.