Crystal structure of cell inhibiting factor (cif) from photorhabdus luminescens
PDB DOI: 10.2210/pdb3gqj/pdb
Classification: UNKNOWN FUNCTION Organism(s): Photorhabdus Luminescens Subsp. Laumondii
Deposited: 2009-03-24 Deposition Author(s): Banfield, M.J. , Crow, A.
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of cell inhibiting factor (cif) from photorhabdus luminescens
Primary Citation of Related Structures: 3GQJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cell Inhibiting Factor (Cif) | A | 261 | Photorhabdus Luminescens Subsp. Laumondii | KNSINTIKLIDDIIALHNDPKGNKLLWNDNWQDKIINRDLANIFEKIDESVSELGGLEMYQEMVGVNPYDPTEPVCGLSAQNIFKLMTEGEHAVDPVEMAQTGKIDGNEFAESVDQLSSAKNYVALVNDRRLGHMFLIDIPSNDQETVGYIYQSDLGQGALPPLKIADWLNSRGKDAVSLNKLKKLLSREFNLLSDDEKRALISETLDIHKDVSNVELDRIKRDRGVDIYLTEYDVNNFYENIETLKSKLSNYDKKLSKPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-24 Deposition Author(s): Banfield, M.J. , Crow, A.