The structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide
PDB DOI: 10.2210/pdb3gq1/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Caulobacter Vibrioides , Synthetic Construct
Deposited: 2009-03-23 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.
Method: X-RAY DIFFRACTION Resolution: 1.496 Å
The structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide
Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.
Primary Citation of Related Structures: 3GQ1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ATP-dependent Clp protease adapter protein clpS | A | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
ATP-dependent Clp protease adapter protein clpS | B | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
WLFVQRDSKE peptide | C | 10 | Caulobacter Vibrioides , Synthetic Construct | WLFVQRDSKE |
WLFVQRDSKE peptide | D | 10 | Caulobacter Vibrioides , Synthetic Construct | WLFVQRDSKE |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-23 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.