Crystal structure of the rag1 nonamer-binding domain with dna
PDB DOI: 10.2210/pdb3gna/pdb
Classification: RECOMBINATION Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-03-16 Deposition Author(s): Bailey, S. , Innis, C.A. , Schatz, D.G. , Steitz, T.A. , Yin, F.F.
Crystal structure of the rag1 nonamer-binding domain with dna
Bailey, S. , Innis, C.A. , Schatz, D.G. , Steitz, T.A. , Yin, F.F.
Primary Citation of Related Structures: 3GNA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
V(D)J recombination-activating protein 1 | A | 96 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPGSHMGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQP |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-16 Deposition Author(s): Bailey, S. , Innis, C.A. , Schatz, D.G. , Steitz, T.A. , Yin, F.F.