Crystal structure of mutant coiled coil gcn4 leucine zipper
PDB DOI: 10.2210/pdb3gjp/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces Cerevisiae
Deposited: 2009-03-09 Deposition Author(s): Honnappa, S. , Steinmetz, M.O.
Crystal structure of mutant coiled coil gcn4 leucine zipper
Honnappa, S. , Steinmetz, M.O.
Primary Citation of Related Structures: 3GJP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
General control protein GCN4 | A | 35 | Saccharomyces Cerevisiae | GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGER |
General control protein GCN4 | B | 35 | Saccharomyces Cerevisiae | GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGER |
General control protein GCN4 | C | 35 | Saccharomyces Cerevisiae | GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGER |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-09 Deposition Author(s): Honnappa, S. , Steinmetz, M.O.