Crystal structure of a cystathionine beta-synthase domain protein fused to a zn-ribbon-like domain
PDB DOI: 10.2210/pdb3ghd/pdb
Classification: Nucleotide binding protein, Metal binding protein Organism(s): Pyrococcus Furiosus
Deposited: 2009-03-03 Deposition Author(s): Brown, G. , Chruszcz, M. , Dong, A. , Edwards, A.M. , Joachimiak, A. , Midwest Center For Structural Genomics (Mcsg) , Minor, W. , Proudfoot, M. , Savchenko, A. , Xu, X. , Yaleunin, A.
Method: X-RAY DIFFRACTION Resolution: 1.81 Å
Crystal structure of a cystathionine beta-synthase domain protein fused to a zn-ribbon-like domain
Brown, G. , Chruszcz, M. , Dong, A. , Edwards, A.M. , Joachimiak, A. , Midwest Center For Structural Genomics (Mcsg) , Minor, W. , Proudfoot, M. , Savchenko, A. , Xu, X. , Yaleunin, A.
Primary Citation of Related Structures: 3GHD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| a cystathionine beta-synthase domain protein fused to a Zn-ribbon-like domain | A | 70 | Pyrococcus Furiosus | KAIVVQPKDTVDRVAKILSRNKAGSAVVMEGDEILGVVTERDILDKVVAKGKNPKEVKVEEIMTKNPVKI |
| a cystathionine beta-synthase domain protein fused to a Zn-ribbon-like domain | B | 70 | Pyrococcus Furiosus | KAIVVQPKDTVDRVAKILSRNKAGSAVVMEGDEILGVVTERDILDKVVAKGKNPKEVKVEEIMTKNPVKI |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-03 Deposition Author(s): Brown, G. , Chruszcz, M. , Dong, A. , Edwards, A.M. , Joachimiak, A. , Midwest Center For Structural Genomics (Mcsg) , Minor, W. , Proudfoot, M. , Savchenko, A. , Xu, X. , Yaleunin, A.