Structures of b1 domain of streptococcal protein g
PDB DOI: 10.2210/pdb3gb1/pdb
Classification: IMMUNOGLOBULIN BINDING PROTEIN Organism(s): Streptococcus Sp. 'Group G'
Deposited: 1999-05-02 Deposition Author(s): Clore, G.M.
Structures of b1 domain of streptococcal protein g
Primary Citation of Related Structures: 3GB1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN (B1 DOMAIN OF STREPTOCOCCAL PROTEIN G) | A | 56 | Streptococcus Sp. 'Group G' | MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE |
Method: SOLUTION NMR
Deposited Date: 1999-05-02 Deposition Author(s): Clore, G.M.