Crystal structure of the second zinc finger from zranb2/znf265 bound to 6 nt ssrna sequence agguaa
PDB DOI: 10.2210/pdb3g9y/pdb
Classification: TRANSCRIPTION/RNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-02-15 Deposition Author(s): Guss, J.M. , Lee, M. , Loughlin, F.E. , Mackay, J.P. , Mcgrath, A.P.
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of the second zinc finger from zranb2/znf265 bound to 6 nt ssrna sequence agguaa
Guss, J.M. , Lee, M. , Loughlin, F.E. , Mackay, J.P. , Mcgrath, A.P.
Primary Citation of Related Structures: 3G9Y
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger Ran-binding domain-containing protein 2 | A | 33 | Homo Sapiens , Synthetic Construct | GSSANDWQCKTCSNVNWARRSECNMCNTPKYAK |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA (5'-R(*AP*GP*GP*UP*AP*A)-3') | c | 6 | NA | AGGUAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-02-15 Deposition Author(s): Guss, J.M. , Lee, M. , Loughlin, F.E. , Mackay, J.P. , Mcgrath, A.P.