Chromodomain of chp1 in complex with histone h3k9me3 peptide
PDB DOI: 10.2210/pdb3g7l/pdb
Classification: NUCLEAR PROTEIN Organism(s): Schizosaccharomyces Pombe , Synthetic Construct
Deposited: 2009-02-10 Deposition Author(s): Joshua-Tor, L. , Schalch, T.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Chromodomain of chp1 in complex with histone h3k9me3 peptide
Primary Citation of Related Structures: 3G7L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromo domain-containing protein 1 | A | 61 | Schizosaccharomyces Pombe , Synthetic Construct | GETDADVYEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKRKK |
| Histone H3.1/H3.2 | P | 16 | Schizosaccharomyces Pombe , Synthetic Construct | ARTKQTARKSTGGKAY |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-02-10 Deposition Author(s): Joshua-Tor, L. , Schalch, T.