3G3P
The structure of the m53a mutant of the caulobacter crescentus clps in complex with a peptide containing an amino-terminal norleucine residue
PDB DOI: 10.2210/pdb3g3p/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Caulobacter Vibrioides , Synthetic Construct
Deposited: 2009-02-02 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.478 Å
The structure of the m53a mutant of the caulobacter crescentus clps in complex with a peptide containing an amino-terminal norleucine residue
Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.
Primary Citation of Related Structures: 3G3P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP-dependent Clp protease adapter protein clpS | A | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
| ATP-dependent Clp protease adapter protein clpS | B | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
| Peptide (NLE)LFVQRDSKE | D | 10 | Caulobacter Vibrioides , Synthetic Construct | LLFVQRDSKE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-02-02 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.