PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

3G03

Structure of human mdm2 in complex with high affinity peptide

PDB DOI: 10.2210/pdb3g03/pdb

Classification: CELL CYCLE
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2009-01-27
Deposition Author(s): Czarna, A.L. , Holak, T.A. , Popowicz, G.M.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.8 Å

3g03
Literature

Structure of human mdm2 in complex with high affinity peptide

Czarna, A.L. , Holak, T.A. , Popowicz, G.M.

Primary Citation of Related Structures: 3G03


Proteins
Molecule Chains Sequence Length Organism Sequence
E3 ubiquitin-protein ligase Mdm2 A 109 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN
E3 ubiquitin-protein ligase Mdm2 C 109 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN
High affinity synthetic peptide B 12 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) LTFEHYWAQLTS
High affinity synthetic peptide D 12 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) LTFEHYWAQLTS
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2009-01-27
Deposition Author(s): Czarna, A.L. , Holak, T.A. , Popowicz, G.M.