Crystal structure of interacting domains of icmr and icmq (seleno-derivative)
PDB DOI: 10.2210/pdb3fxe/pdb
Classification: UNKNOWN FUNCTION Organism(s): Legionella Pneumophila , Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1
Deposited: 2009-01-20 Deposition Author(s): Akey, C.W. , Head, J.F. , Raychaudhury, S.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Crystal structure of interacting domains of icmr and icmq (seleno-derivative)
Akey, C.W. , Head, J.F. , Raychaudhury, S.
Primary Citation of Related Structures: 3FXE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein IcmQ | A | 57 | Legionella Pneumophila , Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 | MKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGAASQAK |
| Protein IcmR | B | 73 | Legionella Pneumophila , Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 | EIGEPDVTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAAMNQPILTTKTER |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-01-20 Deposition Author(s): Akey, C.W. , Head, J.F. , Raychaudhury, S.