Crystal structure of an extremely stable dimeric protein from sulfolobus islandicus
PDB DOI: 10.2210/pdb3ft7/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sulfolobus Islandicus
Deposited: 2009-01-12 Deposition Author(s): Loew, C. , Neumann, P. , Stubbs, M.T. , Weininger, U.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of an extremely stable dimeric protein from sulfolobus islandicus
Loew, C. , Neumann, P. , Stubbs, M.T. , Weininger, U.
Primary Citation of Related Structures: 3FT7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein ORF56 | A | 55 | Sulfolobus Islandicus | GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK |
| Uncharacterized protein ORF56 | B | 55 | Sulfolobus Islandicus | GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-01-12 Deposition Author(s): Loew, C. , Neumann, P. , Stubbs, M.T. , Weininger, U.