Crystal structure of the c-src-sh3 domain
PDB DOI: 10.2210/pdb3fj5/pdb
Classification: TRANSFERASE Organism(s): Caldanaerobius
Deposited: 2008-12-14 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the c-src-sh3 domain
Primary Citation of Related Structures: 3FJ5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 57 | Caldanaerobius | MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
Proto-oncogene tyrosine-protein kinase Src | B | 57 | Caldanaerobius | MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-12-14 Deposition Author(s): Camara-Artigas, A.