Crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution
PDB DOI: 10.2210/pdb3fgv/pdb
Classification: OXIDOREDUCTASE Organism(s): Silicibacter Pomeroyi Dss-3
Deposited: 2008-12-08 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 3FGV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| uncharacterized protein with ferredoxin-like fold | A | 106 | Silicibacter Pomeroyi Dss-3 | GMTESDRDQEASMREVVIVKSTPQRGKFNAFAELVGKLVSETRDFPGCLGAYLMLAPERNEQVVMHIWETPDALEAYLTWRADRGDFLEINEYLEVEQDFKTYQLA |
| uncharacterized protein with ferredoxin-like fold | B | 106 | Silicibacter Pomeroyi Dss-3 | GMTESDRDQEASMREVVIVKSTPQRGKFNAFAELVGKLVSETRDFPGCLGAYLMLAPERNEQVVMHIWETPDALEAYLTWRADRGDFLEINEYLEVEQDFKTYQLA |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-12-08 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)