Crystal structure of the conserved n-terminal domain of the peroxisomal matrix-protein-import receptor, pex14p
PDB DOI: 10.2210/pdb3ff5/pdb
Classification: PROTEIN TRANSPORT Organism(s): Pandinus Imperator
Deposited: 2008-12-01 Deposition Author(s): Fujiki, Y. , Miki, K. , Su, J.-R. , Takeda, K. , Tamura, S.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of the conserved n-terminal domain of the peroxisomal matrix-protein-import receptor, pex14p
Fujiki, Y. , Miki, K. , Su, J.-R. , Takeda, K. , Tamura, S.
Primary Citation of Related Structures: 3FF5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peroxisomal biogenesis factor 14 | A | 54 | Pandinus Imperator | GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS |
Peroxisomal biogenesis factor 14 | B | 54 | Pandinus Imperator | GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-12-01 Deposition Author(s): Fujiki, Y. , Miki, K. , Su, J.-R. , Takeda, K. , Tamura, S.