Design and biological evaluation of novel, balanced dual ppara/g agonists
PDB DOI: 10.2210/pdb3fej/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-11-30 Deposition Author(s): Benz, J. , Binggeli, A. , Grether, U. , Gsell, B. , Hilpert, H. , Kuhn, B. , Maerki, H.P. , Mohr, P. , Ruf, A. , Stihle, M.
Method: X-RAY DIFFRACTION Resolution: 2.01 Å
Design and biological evaluation of novel, balanced dual ppara/g agonists
Benz, J. , Binggeli, A. , Grether, U. , Gsell, B. , Hilpert, H. , Kuhn, B. , Maerki, H.P. , Mohr, P. , Ruf, A. , Stihle, M.
Primary Citation of Related Structures: 3FEJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peroxisome proliferator-activated receptor gamma | A | 271 | Homo Sapiens , Synthetic Construct | ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY |
| peptide motif 3 of Nuclear receptor coactivator 1 | B | 13 | Homo Sapiens , Synthetic Construct | QTSHKLVQLLTTT |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-11-30 Deposition Author(s): Benz, J. , Binggeli, A. , Grether, U. , Gsell, B. , Hilpert, H. , Kuhn, B. , Maerki, H.P. , Mohr, P. , Ruf, A. , Stihle, M.