Crystal structure of the complex of human chromobox homolog 5 (cbx5) with h3k9(me)3 peptide
PDB DOI: 10.2210/pdb3fdt/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-11-26 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of the complex of human chromobox homolog 5 (cbx5) with h3k9(me)3 peptide
Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Primary Citation of Related Structures: 3FDT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 5 | A | 59 | Homo Sapiens , Synthetic Construct | GEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKE |
| H3K9(me)3 peptide | T | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-11-26 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.