Structure of human mdmx in complex with high affinity peptide
PDB DOI: 10.2210/pdb3fdo/pdb
Classification: CELL CYCLE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-11-26 Deposition Author(s): Czarna, A.L. , Holak, T.A. , Popowicz, G.M.
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Structure of human mdmx in complex with high affinity peptide
Czarna, A.L. , Holak, T.A. , Popowicz, G.M.
Primary Citation of Related Structures: 3FDO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein Mdm4 | A | 90 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT |
Synthetic high affinity peptide | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LTFEHYWAQLTS |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-11-26 Deposition Author(s): Czarna, A.L. , Holak, T.A. , Popowicz, G.M.