Structure of sox17 bound to dna
PDB DOI: 10.2210/pdb3f27/pdb
Classification: Transcription/dna Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-10-29 Deposition Author(s): Jauch, R. , Kolatkar, P.R. , Ng, C.K.L. , Palasingam, P.
Structure of sox17 bound to dna
Jauch, R. , Kolatkar, P.R. , Ng, C.K.L. , Palasingam, P.
Primary Citation of Related Structures: 3F27
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor SOX-17 | D | 83 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSFTSRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-10-29 Deposition Author(s): Jauch, R. , Kolatkar, P.R. , Ng, C.K.L. , Palasingam, P.