Structure of the t6 human insulin derivative with nickel at 1.35 a resolution
PDB DOI: 10.2210/pdb3exx/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2008-10-17 Deposition Author(s): Matkovic-Calogovic, D. , Prugovecki, B.
Structure of the t6 human insulin derivative with nickel at 1.35 a resolution
Matkovic-Calogovic, D. , Prugovecki, B.
Primary Citation of Related Structures: 3EXX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin A chain | C | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin B chain | D | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-10-17 Deposition Author(s): Matkovic-Calogovic, D. , Prugovecki, B.