Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dcdp
PDB DOI: 10.2210/pdb3evm/pdb
Classification: TRANSFERASE Organism(s): Acanthamoeba Polyphaga Mimivirus
Deposited: 2008-10-13 Deposition Author(s): Abergel, C. , Claverie, J.M. , Jeudy, S. , Lartigue, A.
Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dcdp
Abergel, C. , Claverie, J.M. , Jeudy, S. , Lartigue, A.
Primary Citation of Related Structures: 3EVM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nucleoside diphosphate kinase | A | 146 | Acanthamoeba Polyphaga Mimivirus | YKKAGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPETKMETDN |
| Nucleoside diphosphate kinase | B | 146 | Acanthamoeba Polyphaga Mimivirus | YKKAGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPETKMETDN |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-10-13 Deposition Author(s): Abergel, C. , Claverie, J.M. , Jeudy, S. , Lartigue, A.