Crystal structure of anthrax-neutralizing single-chain antibody 14b7
PDB DOI: 10.2210/pdb3esu/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus
Deposited: 2008-10-06 Deposition Author(s): Georgiou, G. , Iverson, B.L. , Maynard, J.A. , Monzingo, A.F. , Robertus, J.D.
Crystal structure of anthrax-neutralizing single-chain antibody 14b7
Georgiou, G. , Iverson, B.L. , Maynard, J.A. , Monzingo, A.F. , Robertus, J.D.
Primary Citation of Related Structures: 3ESU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Antibody 14b7* light chain and antibody 14b7* heavy chain linked with a synthetic (GGGGS)4 linker | F | 250 | Mus Musculus | DYKDIVLIQSTSSLSASLGDRVTISCRASQDIRNYLNWYQQKPDGTVKLLIYYTSRLQSGVPSRFSGSGSGTDYSLTISNLEQEDIGTYFCQQGNTLPWTFGGGTKLEIRRGGGGSGGGGSGGGGSGGGGSEVQLQQSGPELVKPGASVKISCKDSGYAFSSSWMNWVKQRPGQGPEWIGRIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSVDSAVYFCARSGLLRYAMDYWGQGTSVTVSS |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-10-06 Deposition Author(s): Georgiou, G. , Iverson, B.L. , Maynard, J.A. , Monzingo, A.F. , Robertus, J.D.