Crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa
PDB DOI: 10.2210/pdb3epy/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2008-09-30 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Kavanagh, K.L. , Murray, J.W. , Oppermann, U. , Salah, E. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J. , Yue, W.W.
Crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Kavanagh, K.L. , Murray, J.W. , Oppermann, U. , Salah, E. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J. , Yue, W.W.
Primary Citation of Related Structures: 3EPY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Acyl-CoA-binding domain-containing protein 7 | A | 89 | Homo Sapiens | SMALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI |
| Acyl-CoA-binding domain-containing protein 7 | B | 89 | Homo Sapiens | SMALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-09-30 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Kavanagh, K.L. , Murray, J.W. , Oppermann, U. , Salah, E. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J. , Yue, W.W.