Crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 a resolution
PDB DOI: 10.2210/pdb3elg/pdb
Classification: MEMBRANE PROTEIN Organism(s): Bacteroides Vulgatus Atcc 8482
Deposited: 2008-09-22 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 3ELG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| uncharacterized periplasmic protein | A | 128 | Bacteroides Vulgatus Atcc 8482 | GAGDVVTRDVNKLPVAAREMIGKHFSQTKVAYIKIEKDLFQTTSYDVKLADGIELEFNSKGEWLEIDCKNKSVPSTFIPQAISKYMKANYNGHKTVKIERNRKGYELTLENGLEVDFDQFGGFLKLSD |
| uncharacterized periplasmic protein | B | 128 | Bacteroides Vulgatus Atcc 8482 | GAGDVVTRDVNKLPVAAREMIGKHFSQTKVAYIKIEKDLFQTTSYDVKLADGIELEFNSKGEWLEIDCKNKSVPSTFIPQAISKYMKANYNGHKTVKIERNRKGYELTLENGLEVDFDQFGGFLKLSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-09-22 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)