Crystal structure of nelfinavir (nfv) complexed with a multidrug variant (act) (v82t/i84v) of hiv-1 protease
PDB DOI: 10.2210/pdb3el5/pdb
Classification: HYDROLASE Organism(s): Hiv-1 M:B_Arv2/Sf2
Deposited: 2008-09-20 Deposition Author(s): King, N. , Prabu-Jeyabalan, M. , Schiffer, C.
Crystal structure of nelfinavir (nfv) complexed with a multidrug variant (act) (v82t/i84v) of hiv-1 protease
King, N. , Prabu-Jeyabalan, M. , Schiffer, C.
Primary Citation of Related Structures: 3EL5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Hiv-1 M:B_Arv2/Sf2 | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
| Protease | B | 99 | Hiv-1 M:B_Arv2/Sf2 | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-09-20 Deposition Author(s): King, N. , Prabu-Jeyabalan, M. , Schiffer, C.