Insulin receptor kinase complexed with an inhibitor
PDB DOI: 10.2210/pdb3ekn/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2008-09-19 Deposition Author(s): Atkins, C. , Chamberlain, S. , Deanda, F. , Dumble, M. , Gerding, R. , Groy, A. , Korenchuk, S. , Kumar, R. , Lei, H. , Mook, R. , Moorthy, G. , Redman, A. , Rowland, J. , Shewchuk, L.
Insulin receptor kinase complexed with an inhibitor
Atkins, C. , Chamberlain, S. , Deanda, F. , Dumble, M. , Gerding, R. , Groy, A. , Korenchuk, S. , Kumar, R. , Lei, H. , Mook, R. , Moorthy, G. , Redman, A. , Rowland, J. , Shewchuk, L.
Primary Citation of Related Structures: 3EKN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin receptor | A | 307 | Homo Sapiens | GVFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRNLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-09-19 Deposition Author(s): Atkins, C. , Chamberlain, S. , Deanda, F. , Dumble, M. , Gerding, R. , Groy, A. , Korenchuk, S. , Kumar, R. , Lei, H. , Mook, R. , Moorthy, G. , Redman, A. , Rowland, J. , Shewchuk, L.