PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

3EG1

Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions

PDB DOI: 10.2210/pdb3eg1/pdb

Classification: Transferase/Signaling protein
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2008-09-10
Deposition Author(s): Camara-Artigas, A.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.85 Å

3eg1
Literature

Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions

Camara-Artigas, A.

Primary Citation of Related Structures: 3EG1


Proteins
Molecule Chains Sequence Length Organism Sequence
Proto-oncogene tyrosine-protein kinase ABL1 A 63 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Proto-oncogene tyrosine-protein kinase ABL1 B 63 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
p41 peptide C 11 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XAPSYSPPPPP
p41 peptide D 11 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XAPSYSPPPPP
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2008-09-10
Deposition Author(s): Camara-Artigas, A.