The crystal structure of the ra domain of flj10324 (radil)
PDB DOI: 10.2210/pdb3ec8/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2008-08-29 Deposition Author(s): Andersson, J. , Arrowsmith, C.H. , Berglund, H. , Collins, R. , Dahlgren, L.G. , Edwards, A.M. , Flodin, S. , Flores, A. , Graslund, S. , Hammarstrom, M. , Johansson, A. , Johansson, I. , Karlberg, T. , Kotenyova, T. , Lehtio, L. , Moche, M. , Nilsson, M.E. , Nordlund, P. , Nyman, T. , Olesen, K. , Persson, C. , Sagemark, J. , Schueler, H. , Structural Genomics Consortium (Sgc) , Thorsell, A.G. , Tresaugues, L. , Van Den Berg, S. , Weigelt, J. , Welin, M. , Wikstrom, M. , Wisniewska, M.
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
The crystal structure of the ra domain of flj10324 (radil)
Andersson, J. , Arrowsmith, C.H. , Berglund, H. , Collins, R. , Dahlgren, L.G. , Edwards, A.M. , Flodin, S. , Flores, A. , Graslund, S. , Hammarstrom, M. , Johansson, A. , Johansson, I. , Karlberg, T. , Kotenyova, T. , Lehtio, L. , Moche, M. , Nilsson, M.E. , Nordlund, P. , Nyman, T. , Olesen, K. , Persson, C. , Sagemark, J. , Schueler, H. , Structural Genomics Consortium (Sgc) , Thorsell, A.G. , Tresaugues, L. , Van Den Berg, S. , Weigelt, J. , Welin, M. , Wikstrom, M. , Wisniewska, M.
Primary Citation of Related Structures: 3EC8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative uncharacterized protein FLJ10324 | A | 166 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGQAGDAGQRWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGINAQARRLQRSRAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-08-29 Deposition Author(s): Andersson, J. , Arrowsmith, C.H. , Berglund, H. , Collins, R. , Dahlgren, L.G. , Edwards, A.M. , Flodin, S. , Flores, A. , Graslund, S. , Hammarstrom, M. , Johansson, A. , Johansson, I. , Karlberg, T. , Kotenyova, T. , Lehtio, L. , Moche, M. , Nilsson, M.E. , Nordlund, P. , Nyman, T. , Olesen, K. , Persson, C. , Sagemark, J. , Schueler, H. , Structural Genomics Consortium (Sgc) , Thorsell, A.G. , Tresaugues, L. , Van Den Berg, S. , Weigelt, J. , Welin, M. , Wikstrom, M. , Wisniewska, M.