Xray structure of scorpion toxin bmbktx1
PDB DOI: 10.2210/pdb3e8y/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2008-08-20 Deposition Author(s): Kent, S.B.H. , Kossiakoff, A.A. , Mandal, K. , Pentelute, B.L. , Tereshko, V.
Method: X-RAY DIFFRACTION Resolution: 1.1 Å
Xray structure of scorpion toxin bmbktx1
Kent, S.B.H. , Kossiakoff, A.A. , Mandal, K. , Pentelute, B.L. , Tereshko, V.
Primary Citation of Related Structures: 3E8Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin alpha-KTx 19.1 | X | 31 | N.A. | AACYSSDCRVKCVAMGFSSGKCINSKCKCYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-08-20 Deposition Author(s): Kent, S.B.H. , Kossiakoff, A.A. , Mandal, K. , Pentelute, B.L. , Tereshko, V.