Midbody targeting of the escrt machinery by a non-canonical coiled-coil in cep55
PDB DOI: 10.2210/pdb3e1r/pdb
Classification: Cell cycle/Transport Protein Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-08-04 Deposition Author(s): Elia, N. , Ghirlando, R. , Hurley, J.H. , Lee, H.H. , Lippincott-Schwartz, J.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Midbody targeting of the escrt machinery by a non-canonical coiled-coil in cep55
Elia, N. , Ghirlando, R. , Hurley, J.H. , Lee, H.H. , Lippincott-Schwartz, J.
Primary Citation of Related Structures: 3E1R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Centrosomal protein of 55 kDa | A | 58 | Homo Sapiens , Synthetic Construct | FNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLP |
Centrosomal protein of 55 kDa | B | 58 | Homo Sapiens , Synthetic Construct | FNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLP |
Programmed cell death 6-interacting protein | C | 13 | Homo Sapiens , Synthetic Construct | QAQGPPYPTYPGY |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-08-04 Deposition Author(s): Elia, N. , Ghirlando, R. , Hurley, J.H. , Lee, H.H. , Lippincott-Schwartz, J.