Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
PDB DOI: 10.2210/pdb3e0e/pdb
Classification: REPLICATION Organism(s): Methanococcus Maripaludis
Deposited: 2008-07-31 Deposition Author(s): Acton, T.B. , Chen, Y. , Everett, J.K. , Foote, E.L. , Hunt, J.F. , Janjua, H. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.
Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
Acton, T.B. , Chen, Y. , Everett, J.K. , Foote, E.L. , Hunt, J.F. , Janjua, H. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.
Primary Citation of Related Structures: 3E0E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Replication protein A | A | 97 | Methanococcus Maripaludis | MNYKISELMPNLSGTINAEVVTAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSL |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-07-31 Deposition Author(s): Acton, T.B. , Chen, Y. , Everett, J.K. , Foote, E.L. , Hunt, J.F. , Janjua, H. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.