3DWU
Transition-state model conformation of the switch i region fitted into the cryo-em map of the eef2.80s.alf4.gdp complex
PDB DOI: 10.2210/pdb3dwu/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Thermus Thermophilus Hb8
Deposited: 2008-07-23 Deposition Author(s): Kjeldgaard, M. , Nissen, P. , Nyborg, J.
Experimental Data Snapshot
Method: ELECTRON MICROSCOPY Resolution: 12.6 Å
Transition-state model conformation of the switch i region fitted into the cryo-em map of the eef2.80s.alf4.gdp complex
Kjeldgaard, M. , Nissen, P. , Nyborg, J.
Primary Citation of Related Structures: 3DWU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Elongation factor Tu-B | A | 46 | Thermus Thermophilus Hb8 | VDHGKTTLTAALTFVTAAENPNVEVKDYGDIDKAPEERARGITINT |
Experimental Data
Method: ELECTRON MICROSCOPY
Deposited Date: 2008-07-23 Deposition Author(s): Kjeldgaard, M. , Nissen, P. , Nyborg, J.