Iodobenzene binding in the hydrophobic cavity of t4 lysozyme l99a mutant
PDB DOI: 10.2210/pdb3dn4/pdb
Classification: HYDROLASE Organism(s): Bacteriophage T4
Deposited: 2008-07-01 Deposition Author(s): Liu, L. , Matthews, B.W.
Iodobenzene binding in the hydrophobic cavity of t4 lysozyme l99a mutant
Primary Citation of Related Structures: 3DN4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lysozyme | A | 164 | Bacteriophage T4 | MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-07-01 Deposition Author(s): Liu, L. , Matthews, B.W.