1.65a crystal structure of isocitrate dehydrogenase from burkholderia pseudomallei
PDB DOI: 10.2210/pdb3dms/pdb
Classification: OXIDOREDUCTASE Organism(s): Burkholderia Pseudomallei
Deposited: 2008-07-01 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
1.65a crystal structure of isocitrate dehydrogenase from burkholderia pseudomallei
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 3DMS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isocitrate dehydrogenase [NADP] | A | 427 | Burkholderia Pseudomallei | MAHHHHHHMPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYGGKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVALRQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKFLQEEMGVKKIRFPQTSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTEGAFRDAGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVVKDSIADAFLQQILLRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHLGWTEAADVIISAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENME |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-07-01 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)