Crystal structure of the b2 box from murf1 in dimeric state
PDB DOI: 10.2210/pdb3ddt/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2008-06-06 Deposition Author(s): Mayans, O. , Mrosek, M.
Crystal structure of the b2 box from murf1 in dimeric state
Primary Citation of Related Structures: 3DDT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase TRIM63 | A | 48 | Homo Sapiens | GAMGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQS |
| E3 ubiquitin-protein ligase TRIM63 | B | 48 | Homo Sapiens | GAMGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQS |
| E3 ubiquitin-protein ligase TRIM63 | C | 48 | Homo Sapiens | GAMGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQS |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-06-06 Deposition Author(s): Mayans, O. , Mrosek, M.