Crystal structure of hiv-1 mutant i54v and inhibitor saquina
PDB DOI: 10.2210/pdb3d1y/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Human Immunodeficiency Virus Type 1
Deposited: 2008-05-06 Deposition Author(s): Liu, F. , Weber, I.T.
Crystal structure of hiv-1 mutant i54v and inhibitor saquina
Primary Citation of Related Structures: 3D1Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 Protease | A | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFVKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| HIV-1 Protease | B | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFVKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-05-06 Deposition Author(s): Liu, F. , Weber, I.T.