Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
PDB DOI: 10.2210/pdb3cg4/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Methanospirillum Hungatei Jf-1
Deposited: 2008-03-04 Deposition Author(s): Almo, S.C. , Bain, K. , Burley, S.K. , Freeman, J. , Hu, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y. , Sauder, J.M. , Smith, D. , Wasserman, S.R.
Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Almo, S.C. , Bain, K. , Burley, S.K. , Freeman, J. , Hu, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y. , Sauder, J.M. , Smith, D. , Wasserman, S.R.
Primary Citation of Related Structures: 3CG4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Response regulator receiver domain protein (CheY-like) | A | 142 | Methanospirillum Hungatei Jf-1 | MSLAEHKGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSLEQGIAIVMLTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQTGNEGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-03-04 Deposition Author(s): Almo, S.C. , Bain, K. , Burley, S.K. , Freeman, J. , Hu, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y. , Sauder, J.M. , Smith, D. , Wasserman, S.R.