Crystal structure of the response regulator receiver domain of a signal transduction histidine kinase from aspergillus oryzae
PDB DOI: 10.2210/pdb3c97/pdb
Classification: SIGNALING PROTEIN, TRANSFERASE Organism(s): Aspergillus Oryzae Rib40
Deposited: 2008-02-15 Deposition Author(s): Almo, S.C. , Bain, K.T. , Bonanno, J.B. , Burley, S.K. , Chang, S. , Freeman, J. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Romero, R. , Sauder, J.M. , Smith, D. , Wasserman, S.
Crystal structure of the response regulator receiver domain of a signal transduction histidine kinase from aspergillus oryzae
Almo, S.C. , Bain, K.T. , Bonanno, J.B. , Burley, S.K. , Chang, S. , Freeman, J. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Romero, R. , Sauder, J.M. , Smith, D. , Wasserman, S.
Primary Citation of Related Structures: 3C97
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Signal transduction histidine kinase | A | 140 | Aspergillus Oryzae Rib40 | MSLEPSQIMPLSVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLEAVSEIRNYERTHNTKRASIIAITADTIDDDRPGAELDEYVSKPLNPNQLRDVVLTCHSEGAEGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-02-15 Deposition Author(s): Almo, S.C. , Bain, K.T. , Bonanno, J.B. , Burley, S.K. , Chang, S. , Freeman, J. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Romero, R. , Sauder, J.M. , Smith, D. , Wasserman, S.